PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK26741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 342aa    MW: 39685.5 Da    PI: 7.5644
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK26741.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.84e-57171431129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeel+++yL +kv ++++++ ++i evd++k+ePwdLp ++k +ekewyfF++rd+ky+tg r+nrat++gyWkatgkdke+++ +++lv
  PK26741.1  17 LPPGFRFHPTDEELISHYLSPKVLNNRFSA-RAIGEVDLNKCEPWDLPWRAKMGEKEWYFFCQRDRKYPTGLRTNRATEAGYWKATGKDKEIFK-GKTLV 114
                79***************************9.89***************888999****************************************.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrle 129
                g+kktLvfykgrapkgek++Wvmheyrle
  PK26741.1 115 GMKKTLVFYKGRAPKGEKSNWVMHEYRLE 143
                ***************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-6513167IPR003441NAC domain
PROSITE profilePS5100560.30517167IPR003441NAC domain
PfamPF023651.2E-3018142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MENKSGVCKE DHELMELPPG FRFHPTDEEL ISHYLSPKVL NNRFSARAIG EVDLNKCEPW  60
DLPWRAKMGE KEWYFFCQRD RKYPTGLRTN RATEAGYWKA TGKDKEIFKG KTLVGMKKTL  120
VFYKGRAPKG EKSNWVMHEY RLEGKYSVYN LSRETKNEWV ICRIFQKSCG GKKTHISGLV  180
RLSSYGSLLP PLMESSPPYN NDPRTTTVTN TSSNNSTATH VTCFSDPMED QKSQQHQTMN  240
NNNIQSFNNH HHHQNSLFSH NQIIIQERFG NLQYPDSLLM QEDSILSMLI ENNNNQAPEM  300
KLCRSSKTEF ETEFRINDRS FDEQNDPSSS VGPVDLDCLW NY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-531517315171NO APICAL MERISTEM PROTEIN
1ut4_B2e-531517315171NO APICAL MERISTEM PROTEIN
1ut7_A2e-531517315171NO APICAL MERISTEM PROTEIN
1ut7_B2e-531517315171NO APICAL MERISTEM PROTEIN
3swm_A2e-531517318174NAC domain-containing protein 19
3swm_B2e-531517318174NAC domain-containing protein 19
3swm_C2e-531517318174NAC domain-containing protein 19
3swm_D2e-531517318174NAC domain-containing protein 19
3swp_A2e-531517318174NAC domain-containing protein 19
3swp_B2e-531517318174NAC domain-containing protein 19
3swp_C2e-531517318174NAC domain-containing protein 19
3swp_D2e-531517318174NAC domain-containing protein 19
4dul_A2e-531517315171NAC domain-containing protein 19
4dul_B2e-531517315171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088131.11e-165NAC domain-containing protein 100
SwissprotQ9FLJ21e-132NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A060A6521e-167A0A060A652_BOENI; NAC domain-containing protein
STRINGVIT_14s0108g01070.t011e-142(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-120NAC domain containing protein 100